PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G037630_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family NF-YA
Protein Properties Length: 90aa    MW: 10062.6 Da    PI: 12.3854
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G037630_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.71.7e-322478156
          CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgG 56
                       +ep++VNaKQy++Il+RRqkRakle+++kl  k+rkpylheSRh+hA++R Rg+gG
  GRMZM2G037630_P01 24 EEPIFVNAKQYNAILRRRQKRAKLEAQNKL-VKGRKPYLHESRHRHAMKRVRGPGG 78
                       69****************************.************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-312283IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.3122383IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-272578IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-212648IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602848IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-215780IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MQVHPQISGA ANTRVPLPVG PAAEEPIFVN AKQYNAILRR RQKRAKLEAQ NKLVKGRKPY  60
LHESRHRHAM KRVRGPGGVS STKRSSRSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-212478256NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13845RRRQKRAK
23946RRQKRAKL
36473RHRHAMKRVR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.279421e-147endosperm| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G037630
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G037630_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9618651e-145EU961865.1 Zea mays clone 238735 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467701.12e-46hypothetical protein SORBIDRAFT_01g032710
SwissprotQ9LVJ71e-32NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A096QDU42e-59A0A096QDU4_MAIZE; Uncharacterized protein
STRINGGRMZM2G037630_P016e-59(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.16e-33nuclear factor Y, subunit A6